DPCstruct | MC14765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 4.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9INV2 | 152-217 | FRLLTLAWSDGASLVPIDFALLSSTSPSNRYQGVLKELDRRTCGARRRREAVTKSTSLLAPMVQRA |
| A0A0U3CXC5 | 7-71 | FRMMTMGWTDGSSFVPIASSLLSSKNNQNVIGTTKKIDKRTIAAKRRIMAQSKGTDVVSSLESRA |
| F0K2Z9 | 1-75 | None |
| A0A0F3GQV3 | 2-63 | None |
| A0A0W1JI51 | 1-63 | None |
| A0A7W5C815 | 28-95 | None |
| A0A5B7TLV4 | 12-77 | None |
| A0A1H8IH90 | 1-74 | None |
| E8LFH0 | 5-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.