DPCstruct | MC14764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 111 ± 14 aa |
| Standard deviation of domain lengths | 13.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842UT70 | 121-214 | AAEPIGGQRDEQGCLGPAGYTWVASIGGCVRTWELDDQQKFAAKTAIDKIGQQYGLTVVEVMTAGCPGCFTVKLTDADNRPIQVTLK… |
| A0A1G2BSM5 | 4-132 | TTIAIIALIIIGALAYYFTPVGTIRKDRADLPLEGAGGEDCGEDASYSWDDSLGACVRARELDQTLRNVARTALDYIGSREGTMTVT… |
| A0A5E4JNY7 | 9-131 | None |
| A0A842S7S8 | 183-273 | None |
| A0A832WSL8 | 3-122 | None |
| A0A7K4BYI7 | 46-146 | None |
| A0A1D2R8A8 | 8-132 | None |
| A0A151E8Y2 | 9-113 | None |
| A0A7C1HTB8 | 65-157 | None |
| A0A2D6KD00 | 10-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.