DPCstruct | MC14763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 339 |
|---|---|
| Mean domain length (aa) | 245 ± 52 aa |
| Standard deviation of domain lengths | 51.80 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.81 |
| Pfam Score | 88.32 |
| Assigned Pfam label(s) | PF11918- CL0127- PF11818- CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2BPZ3 | 46-262 | GTEVILTIYRAETGLTSEYRITRERVEIPSVDAAVLDNNIAYIEFSLFSDEVIDDFQKLFGPVINESTSGIVLDLRNNIGGLTHVAV… |
| A0A3D0MVK2 | 67-270 | QYLEEMKFINFGIEKIERLKGNIGYIDIRMFPDINIAKDKYIAAMKMLEDSEALIIDLRKHSGGDPATVQFLCSYFFDGEPFLLNSI… |
| A0A177WS83 | 341-616 | None |
| B0ECA0 | 158-476 | None |
| A0A177WRD4 | 289-611 | None |
| A0A177WN80 | 193-463 | None |
| A0A177WIH4 | 37-333 | None |
| A0A177WBP1 | 200-481 | None |
| A0A139NZE0 | 1-144 | None |
| A0A351T685 | 57-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.