DPCstruct | MC14759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 104 ± 7 aa |
| Standard deviation of domain lengths | 7.34 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.41 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0010- PF01448 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J8LDK2 | 1-81 | MEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVP |
| A0A183JVJ8 | 1-96 | MLIVESEDVRLTEVHEELVWSPSHSLTVQEIDMFCLLAKAVGTYGRAHDTSSSTRQPLLLSATASAARDITRQHAHDILHEANYDLN… |
| A0A0V0Y6C9 | 259-365 | None |
| H3A8C9 | 1-95 | None |
| A0A3P8F421 | 118-226 | None |
| A0A673H3J7 | 118-213 | None |
| A0A6V7WA97 | 60-163 | None |
| A0A0S7JXC9 | 1-96 | None |
| W2T4H7 | 233-339 | None |
| A0A168H9W7 | 210-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.