DPCstruct | MC14758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 256 ± 15 aa |
| Standard deviation of domain lengths | 14.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16969 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2M5H9 | 96-331 | LNEEEVILYKQRVEELVPNIRYCAYNIGDESAINDLLKMRLSGKTAGEDLLANDLDHLIAQTREKQAVTLSEVEWRNRKIPVRHEKI… |
| A0A183JUC4 | 1-263 | MVDEDSQAVYKSRIDDLLPQIRYCAHSIGDETAATDLQRMRNQAPDGLTLLSELQLDQLLGQARSRQASQVSEVDWLGTSIPVKSEK… |
| A0A6A6MGN1 | 122-364 | None |
| A0A2G8LN72 | 87-324 | None |
| H0EG18 | 1-252 | None |
| A0A369RQW6 | 188-429 | None |
| A0A819AC88 | 341-605 | None |
| A0A0C3QFL5 | 181-447 | None |
| A0A139AGK0 | 251-522 | None |
| A0A2H1CCN9 | 2-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.