DPCstruct | MC14757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 7.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 62.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183JTN1 | 1-79 | KGDIFGQPIFKDTDVGQSAASVRALTYCDLQCIKRDKLIDILKFYSQFAVSFSRTLVLSYNLRNRVSSFLSFIYAYFVV |
| A0A1B0D1M0 | 1-89 | DEVVAILGKGDVFGDQFWKDSAVGQSAANVRALTYCDLHAIKRDKLLEVLDFYQAFANSFARNLVLTYNLRHRLIFRKVADVKREKE… |
| A0A484C5N0 | 1-88 | None |
| A0A4Z2ECL3 | 17-89 | None |
| A0A183M2R8 | 1-82 | None |
| A0A0M3IDH5 | 97-168 | None |
| A0A1S8WT89 | 7-79 | None |
| A0A4W5QIP8 | 9-94 | None |
| A0A183A8J2 | 7-90 | None |
| A0A2H1BX51 | 11-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.