DPCstruct | MC14756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 158 ± 9 aa |
| Standard deviation of domain lengths | 9.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 29.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0760 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O62191 | 874-1032 | IEAIKNSLIEKNSEIYIERWKMTEVSDSPLFLSKWKGWNMRAFADVTLHGTEKCIQMMKAFDPLSPIPEQNYSTLWARAVEFDVDEW… |
| A0A183RXK0 | 1-152 | MQRAKDYRNRLHRFYCDYAFSDELFTFTMDNLKIKALADESITHGEQVIAQMKIMDSDSPWPNLTEQDFSTLWCRIITMNVERWRLQ… |
| A0A453I191 | 84-259 | None |
| A0A0B1T5E4 | 6-147 | None |
| E9I117 | 56-217 | None |
| A0A2S2NI76 | 164-325 | None |
| G7YXF0 | 522-688 | None |
| H2XWT7 | 8-170 | None |
| A0A821G158 | 864-1016 | None |
| A0A0N4XI17 | 19-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.