DPCstruct | MC14753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 4.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7IZP1 | 32-101 | DMVSDKRIGNITCPILMMHAENDHVIPVALARKLKDAAVAAGRDVKYVEFESAKNYKHKFIYMAPDLSSL |
| A0A183JK75 | 7-64 | PIVILHAEDDAVVPFTLGKKLAEILSTNGTSVFFKPYEGKLGYRHNFIHTAPDLPDII |
| A0A7J7ASY8 | 265-335 | None |
| A0A6P6XW39 | 304-372 | None |
| A0A3Q1ED09 | 375-445 | None |
| A0A2A6BZ20 | 358-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.