DPCstruct | MC14750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 264 ± 46 aa |
| Standard deviation of domain lengths | 45.63 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11262 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446NZT9 | 242-534 | FWGLTLYDLHFPKDRYDAETKKLHDNLKQLEDNSDNSSIAISRRKKDKERIQDLVDKLNNESDKHQQHVASVLQRLAREKDKWLSSG… |
| A0A183JGN7 | 23-302 | CNEIAAAIRPLYPARVWDELGIVFFITFWSLQSSDLVVPESAYQRQIQQLKEQIQQIDTPASGWNSTKKKREIERLENLIERLTNEQ… |
| A0A3P6RJA2 | 17-323 | None |
| A0A812VUU2 | 88-363 | None |
| A0A6V7VLV6 | 149-462 | None |
| H2XEG6 | 6-226 | None |
| A0A3P7IQT9 | 4-216 | None |
| G0QWL3 | 51-333 | None |
| S6BN20 | 3-301 | None |
| A0A2C9JZK7 | 413-642 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.