DPCstruct | MC14749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 227 ± 55 aa |
| Standard deviation of domain lengths | 55.08 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 74.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q504E3 | 37-239 | PESLLFVSTLDGNLHAVSKISGTIKWTLKEDPVLQVPTHVSEPAFLPDPNDGSLYSLGGKNNEGLTKLPFTIPELVQASPCRSSDGI… |
| A0A183JFG2 | 42-280 | KIPNDSYILVHTLGGEILCVHRRSGHVKWKFDSGMLFLNYLHSVVLASALSASYDNGPLLVVDPISGSLYEYASSVSEFLFQLLDHS… |
| A0A0H2S1Y3 | 2-385 | None |
| A0A267FYU7 | 286-598 | None |
| A0A022RXM0 | 13-159 | None |
| A0A7S3UGJ2 | 66-333 | None |
| A0A5J4WXM0 | 10-229 | None |
| H9JGH9 | 2-218 | None |
| A0A7R8ZAU1 | 44-225 | None |
| A0A6J8AXM2 | 176-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.