DPCstruct | MC14745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 126 ± 25 aa |
| Standard deviation of domain lengths | 25.46 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0287 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7XY81 | 1-116 | EKKTIPSDDSEHKMLITHVAFEPSLLHECVPKKSTNVFLTASVVNNSEFPLLEGDASVYLNHSFVAKTHLKAVAPGEKFTCSLGVDN… |
| A0A1F8TJR5 | 2-96 | TYTIPGLVNIPPDGAAHKVTIAHFQLPPQLDYVSAPRLMEAVYRRAKIKNDSPYTLLGGEASLFIGDEFIGTSPLEMTAPQGEVELS… |
| A0A183TDF5 | 1-177 | None |
| A0A7Z7KPI1 | 1-140 | None |
| L2FM74 | 10-112 | None |
| E2LWC5 | 5-111 | None |
| A0A5K3EL61 | 474-662 | None |
| A0A2E8CW97 | 86-201 | None |
| A0A7X9KNT9 | 60-160 | None |
| A0A4T0J2J1 | 403-551 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.