DPCstruct | MC14740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 8.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820SQB4 | 150-236 | GIVVDVNPLIINQNLVYIEQGTSNELDVSTLSSPYRTIACSKDNWPAMASNNHFLLIDQYPNLCLYDKELTLLKEYPWDYDKIPDMC |
| A0A816I0N5 | 1-93 | NQFEEHGILVDVYPLIINQNLVYIEESTSNELDISTLSSPYRSIDCSNNDWPVLASNNQFLILDQYPNLCLFNKELTLLKQTSWEYD… |
| A0A818AJ52 | 147-246 | None |
| A0A816MX53 | 1-108 | None |
| A0A821A9W3 | 16-117 | None |
| A0A817IZE1 | 146-247 | None |
| A0A818SPG6 | 144-244 | None |
| A0A815DLK7 | 97-193 | None |
| A0A814UZP1 | 120-237 | None |
| A0A821UZK3 | 147-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.