DPCstruct | MC1474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 8.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20722 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9Z371 | 25-129 | FVVGCTALHLAYNPSIRNISVNEVAIMFNLPDLRPALADFLHREVTSGHCVHAISGPQRAGPEAELPFDKLQVWFKIRLQETDFHDA… |
| A0A0C9YMB6 | 255-354 | FTSSTTAVHLATKPHHRMTVDEAVTLFDLPDLLSAIHDCFNRCANGIDHDISGRRRASLNYSLPSNKIQIWTKVRMQVRNYHNPEMV… |
| F8PGH9 | 76-153 | None |
| A0A0C3CAW3 | 237-331 | None |
| A0A5B1R8W8 | 437-543 | None |
| A0A1Q3ENY7 | 293-391 | None |
| A0A0D0A9T6 | 187-289 | None |
| A0A0D0A5M2 | 1-106 | None |
| A0A0D0A501 | 92-194 | None |
| A0A0C9ZSS3 | 764-853 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.