DPCstruct | MC14738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 116 ± 4 aa |
| Standard deviation of domain lengths | 3.87 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 61.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9V4L0 | 348-464 | PQQRIEDMMRVTEYCIDLLKENEEHHGEAFAWFSDLLADHSEIFWSLYSVDLDSAMEVQPPDSWDSFPLFQTLNDFLLSEKSLNGGI… |
| A0A816HW65 | 1-119 | MILQEKKIDDLIHLAEICIELLLQDSEHYPEAFKQYNDLLIEHEEIFWSLFAVDMEHVIDQQPIESWDSFPLFQLLNDYLRQHDTLS… |
| A0A7J5Z646 | 230-346 | None |
| A0A183STY3 | 25-136 | None |
| A0A6I9Q7J2 | 379-497 | None |
| A0A183P4E9 | 345-456 | None |
| A0A0D6LTN9 | 407-523 | None |
| A0A5C6N7C4 | 698-813 | None |
| Q60PC0 | 926-1042 | None |
| A0A7J5Z0T4 | 19-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.