DPCstruct | MC14737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 75 ± 2 aa |
| Standard deviation of domain lengths | 1.85 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 90.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 55.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9EZF1 | 53-129 | HQILTLRTAVNLFFKLKQMKTCASFCKRLLELGPKAEVAAQIRKVLAVAEKEPNDTHELQYDEHNPFVVCSRKFKPL |
| A0A816HT00 | 1-76 | MHKIIKLKSAVNQAFKLKIYTTATSFTKRLLELEPTPDTRKVLSVCEKNPIDEHPLNYDEYNPFNICAASNVPHLS |
| A0A5J5PHC4 | 241-315 | None |
| A0A498I557 | 3-75 | None |
| A0A820BYS4 | 382-457 | None |
| A0A1U8PX65 | 187-261 | None |
| A0A150FTP1 | 5-74 | None |
| A0A7F8RQJ6 | 553-627 | None |
| A0A803WD19 | 948-1021 | None |
| A0A1S3I493 | 260-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.