DPCstruct | MC14735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 4.18 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 88.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821D760 | 40-98 | HFIYRIAEFLVMLSHDTLHSKQVIKVQDLIKHCDSLLASGHEPETHALSALEPVVYDLF |
| A0A816H4L8 | 1-66 | HFIYCIAEFLVMLSHDTLHSKQVIKIQGLIKHYDSLLASGHEPETHTLAALEPVLYDFFSCSSYAN |
| A0A815PRR0 | 155-224 | None |
| A0A813VN11 | 2-72 | None |
| A0A819DLC0 | 199-262 | None |
| A0A822DD08 | 1-76 | None |
| A0A822CWQ4 | 2-64 | None |
| A0A815RT59 | 110-173 | None |
| A0A815JB00 | 50-120 | None |
| A0A814G935 | 167-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.