DPCstruct | MC14734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 153 ± 13 aa |
| Standard deviation of domain lengths | 12.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0090 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816GQ15 | 41-193 | MVFEPARNLAPQVSIDDCRRLELANILRDKESREALIGQWMFLIEEKNETELLNIEKLLILLAGICDYLDQANANSLEHALDQICNR… |
| A0A016S0H5 | 2-140 | LKKDSERRHTLAQFMSDYSEQIIDTWMHGIIASMDSAEVVVTMHMLETLLDGMREFLLKKETKHIQDALDEIRCLLDYDTAKISQVN… |
| A0A820PBP4 | 1-138 | None |
| A0A813SKU5 | 1-153 | None |
| T1K0D3 | 428-579 | None |
| A0A803XMC1 | 2-152 | None |
| G3NPC6 | 935-1090 | None |
| A0A819FI02 | 554-704 | None |
| J9AJ18 | 18-152 | None |
| A0A4U5MC03 | 565-726 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.