DPCstruct | MC14733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 54 ± 9 aa |
| Standard deviation of domain lengths | 9.41 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18974 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368A2K9 | 2-46 | ERVDLVVPFEEKEEAKQLGARWDKTYKIWYVPEGINPDHFQRWFP |
| A0A1W9J8Q5 | 9-66 | IKSKMNTTTNITLKVPFSEKDQAKSLGARWNVEAKHWYVPAGIDATPFEKWFTSSPNM |
| A0A0C1XYX3 | 120-164 | None |
| A0A1C4BP06 | 178-225 | None |
| A0A809NJ53 | 56-120 | None |
| A0A3A3FTU9 | 38-89 | None |
| A0A5E7QCU6 | 23-88 | None |
| A0A231HH24 | 2-53 | None |
| A0A2N9YBJ7 | 3-58 | None |
| A0A2W7GXP3 | 5-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.