DPCstruct | MC14732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 175 ± 15 aa |
| Standard deviation of domain lengths | 15.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8Q231 | 243-402 | PLPNSYPSRFLSEENTTTIPTSYNHSLAANKVFQAEHDHNANVLWTEKERERAVRGHVATDTNDLRTQLQSLYQGGVKATCGTYLRI… |
| A0A0C3E7W2 | 1-176 | MVEPTNPDQLISSTVLFNVDVIETTFDRLSPVNAAFSALHNRQDNIAWTDSEQNKAALGTPIQNFQGFYSEGQKISEDAYICIPMSV… |
| F8P111 | 400-559 | None |
| A0A409YHV5 | 669-870 | None |
| A0A4V1Q1X9 | 530-706 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.