DPCstruct | MC14731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 127 ± 7 aa |
| Standard deviation of domain lengths | 6.75 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 24.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8LYC4 | 232-358 | PNTAATCLLFSRNYVPSAGKPRASDYDSEGKAIILRAAAYYEAKIIGVGAFPDRAMQIGWANKAFKDGCRVAGKDYEPDDRVRTIIR… |
| A0A0C3E6D1 | 6-119 | KAQKLTEHKGRPRARDYDDVTQEFINMAIGDYHAHLCAEGPMPDHAQETTLLNMSWAKAFQTTGVNLVQTAQLTKLITNCGSQVRGK… |
| S7RBS3 | 87-219 | None |
| A0A0D0AEU4 | 13-138 | None |
| A0A0D0A1T4 | 2-132 | None |
| A0A4Y9YBC5 | 272-406 | None |
| S7RSR2 | 310-436 | None |
| A0A0C9Y255 | 7-136 | None |
| A0A0C9ZNW9 | 8-120 | None |
| A0A060SHZ4 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.