DPCstruct | MC14730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 224 ± 47 aa |
| Standard deviation of domain lengths | 46.58 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3E0V4 | 13-243 | SQNNDTKHNPLPRALFHSNNYPRPLDLWAKEIQDLGASDRSDYRIQKISHWKRPISGDEHLRVHLQHPSGRKVVIDADRMMMMGSPY… |
| A0A074S634 | 29-172 | YLVIDFPFILDSGWYQEQPCIEFRTFQHRKEREGLRHEFIVLKLLDGSVCRVERMGNPNARLNALATQGSVAQDIAQCFGSESEAHL… |
| A0A0K6FZS5 | 19-209 | None |
| F8NNZ3 | 13-212 | None |
| A0A2A9NKW3 | 20-248 | None |
| A0A2A9NL46 | 11-214 | None |
| A0A0D0AIE7 | 7-220 | None |
| F8Q7K9 | 1-218 | None |
| E2LR33 | 2-250 | None |
| A0A3D8RER9 | 165-413 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.