DPCstruct | MC1473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 124 ± 22 aa |
| Standard deviation of domain lengths | 21.95 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G8CEA8 | 2-108 | NAFTSVNTVTTPLTINCNSVTTYNGDPNETTKVTFNYQNNLLWATQVNNTASTQILAADAPAGPVILRAGAKVTLQNVGAGFSILFT… |
| A0A0C9ZUB7 | 22-131 | DAFVCALRSNDKDAKTYKIVIGPLEIDIAVDLNKLTIVIEVYAYIPFIGKVQIVKTSGNLREGIAFTIGFPPFIGGSLTLKLDGKDV… |
| A0A164RUN2 | 27-156 | None |
| A0A4R2P187 | 1-101 | None |
| A0A5K1JYC0 | 1-190 | None |
| A0A511N4Q6 | 3-126 | None |
| A0A0C3A831 | 55-181 | None |
| A0A4R8T4E0 | 519-641 | None |
| U9SQW7 | 3-114 | None |
| A0A4Y7TI31 | 1-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.