DPCstruct | MC14727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 129 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3DNQ0 | 1-139 | MSVDDPSFISKLWEKHVAILDQHPPKKTFQDWIHLGQKFAQLAAGGTIYVLLIIASLNLRWCIRKASWRTVSDLGKMLRVPVLSPWN… |
| S8G5B5 | 46-166 | EDAPSYRTLRSWYSRGTKLARLAEGGSVYMLLWLAHADLRAPFVEADGTLAGDIANALRCPEHDSSTGSLVRDNIIPTIAYLSERCP… |
| A0A0C3ANX5 | 1-136 | None |
| F8Q5G5 | 158-269 | None |
| F8Q231 | 43-177 | None |
| F8P5U9 | 82-208 | None |
| F8NJN1 | 153-286 | None |
| A0A0D0AXZ6 | 1-127 | None |
| A0A0C9T776 | 2-108 | None |
| A0A0C3DCF0 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.