DPCstruct | MC14725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 154 ± 40 aa |
| Standard deviation of domain lengths | 39.54 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 80.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 19.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3DEG1 | 16-167 | KVDLERAHAAKKVLEQRVATAHATGGMAENTIEKPKGSPGDPDFSLINVMELQDDKLSYLAIQRTIRDLCHAARLDWNRTYHEQPTR… |
| A0A2G8S0L4 | 203-304 | DDDLISKPDGEVGRHRRGYSLPVVLGWPQSQLKRAQALVKSYVQSYLDHSYSSSHQPVDHVTMLTDLIVAKHPGLVEQYRDGWPIRD… |
| A0A5C2SK93 | 1-179 | None |
| A0A165XZU7 | 13-234 | None |
| A0A0C3BSQ8 | 31-198 | None |
| A0A5K1K4U7 | 39-159 | None |
| V2X4B9 | 3-163 | None |
| A0A2I1F1R1 | 79-214 | None |
| A0A0C9T7N4 | 69-232 | None |
| V2X4F2 | 4-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.