DPCstruct | MC14721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 238 ± 49 aa |
| Standard deviation of domain lengths | 48.78 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317XKM0 | 181-470 | RVCLKIPQKLPPPQLCPNSSPHKDLVGHLFRHNLLEEAREAHNSTMPPEYMLDAFLSLGQRGSTNLYQQAQLFLSSHQQDVSDHIKP… |
| A0A0C3D5Q9 | 16-274 | LPRTLQRPPYAEVPRQNVLAVAPELADVAIEYVRRGLRVQANQMLAGVSALSPSHLPPTIPRAQLPQTTSLTIPLRPAQHPISSPTH… |
| X8JQI5 | 545-812 | None |
| A0A0M9VR22 | 11-343 | None |
| A0A6A4GWW7 | 4-188 | None |
| J5Q8S8 | 81-363 | None |
| A0A146HP32 | 399-673 | None |
| G4TT88 | 124-380 | None |
| R4XEJ3 | 103-253 | None |
| A0A137QYE9 | 7-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.