DPCstruct | MC14720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 80 ± 11 aa |
| Standard deviation of domain lengths | 10.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 46.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8ZIF2 | 19-103 | CGVLGAFLVMVPEAFAIVVAPTDNSRGYGIFRVSEPNGMSLLKECQEKGSQFHSHDETVDGGPIYERCTHVYKNSNLRFEIFDLR |
| A0A0C3DD23 | 6-85 | LHTHSGFQRMLPESFAVVCAPKFTPNFGIFRLTDPPGLQTILECNAKEAFHPHPDVPIYTDADKGHVQMKDMALEIVDLR |
| A0A482RDP3 | 5-110 | None |
| M1AL58 | 1-73 | None |
| A0A164NSZ6 | 116-183 | None |
| M8CC44 | 447-513 | None |
| A0A7J8GHX3 | 111-224 | None |
| A0A835PKM7 | 1110-1190 | None |
| A0A482X7C9 | 186-281 | None |
| A0A177U7A3 | 731-818 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.