DPCstruct | MC14719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 369 ± 55 aa |
| Standard deviation of domain lengths | 54.50 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 36.77 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | PF04833- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151QQ21 | 112-539 | KLAKKTKYPPRRYGDLTIAYDVLQANQNNYYVQVTIDNNHPLGRLDHWNLTWEWQKGEFIYSMKGAFARIKDPSECLYGTAGKFYKD… |
| A0A7J8YXN3 | 1-349 | MYRQIRSPGWTIGWTWANKEVIWSMVGAQAIDQGDCSNFKTNIPHSCETSPAIVDLLPGSVPQNQQLPNCCKGGVLGSWGQRDKAAT… |
| A0A388L0Y9 | 2-391 | None |
| A0A1R3IBC7 | 15-339 | None |
| A0A6A4P631 | 14-419 | None |
| A0A811MKD9 | 38-322 | None |
| A0A022RCD7 | 3-310 | None |
| A0A6A6L0W5 | 280-647 | None |
| A0A803QCC8 | 749-1177 | None |
| A0A438DUV7 | 110-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.