DPCstruct | MC14713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 104 ± 10 aa |
| Standard deviation of domain lengths | 9.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4R6J0 | 249-348 | NPWLSYGLPLHRMRESGFRIDVLDEIDERPLTYEELKALACLLFGSTGGLTIPDPRMNWGGFLNAVSVAQSREKAVWNPIRRRLTPW… |
| A0A7S2V7T8 | 1-103 | NPWLNYTLPLHRMREMGHHDRLFDLIDERKLTRTEIRDFCVLLFGQDALDGAPDPAADWKGFIKVVEQAVDATPEQWNPIKKRTKPL… |
| A0A7S3AZZ4 | 161-266 | None |
| K0SCJ7 | 389-487 | None |
| A0A830HB93 | 329-452 | None |
| A0A7S2EDQ8 | 1-86 | None |
| A0A7S4R2B8 | 417-516 | None |
| A0A7S2S344 | 60-161 | None |
| A0A7S1TU00 | 64-182 | None |
| A0A7S4T867 | 162-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.