DPCstruct | MC14712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 283 ± 31 aa |
| Standard deviation of domain lengths | 31.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10156 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3Q3H6 | 161-467 | DAIAMAERSRSASGSRREGAGGGGSASASASALFDNAAPLSVVHCHEGEVKVQLNSEYALTVKLVDVKNTSTNDNTPEDGSRSGSGE… |
| A0A6U3DUA1 | 1-314 | MFDAIRREVASDTEEVGQVRTTASAVERATLWVSTSGSAHNQQEQQQFLPTPGAMVRGDLGLGQGIAVIHCHEGEVMIQLDSEYTLR… |
| A0A811P4D0 | 247-570 | None |
| A0A287XNG9 | 3-266 | None |
| A0A0D2QKE0 | 297-552 | None |
| A0A446X0C5 | 99-408 | None |
| A0A7J8YVF9 | 1-242 | None |
| A0A6S7KV54 | 13-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.