DPCstruct | MC14711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 202 ± 28 aa |
| Standard deviation of domain lengths | 27.67 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2EW77 | 68-267 | SERDDFVGSGTSALRPLSLPTFVTTAGEQTVEVEGGGWRIELPPGGKGRASTLRFWLDFPNGADRNGATLPPGRSYFIAPCWRLNEL… |
| A0A6U3DFG1 | 20-201 | IVKNGSLIDLSGMKKIPFQDGSWEMAWKEGAHNGMVVCAFDLPETVSRNDNSLPPCRMYVEFPIWTKEGLMEDQAYKLVLDERRQAN… |
| A0A7S2EUQ9 | 5-198 | None |
| B8CEX3 | 14-247 | None |
| B8BRX4 | 583-797 | None |
| A0A6T8HBS3 | 33-221 | None |
| A0A1E7EKH1 | 16-275 | None |
| A0A7S0EPS3 | 75-271 | None |
| A0A7S0T830 | 158-361 | None |
| A0A7S2KBS9 | 108-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.