DPCstruct | MC1471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 253 ± 53 aa |
| Standard deviation of domain lengths | 53.16 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.87 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167QGR7 | 55-255 | VSGPTVVVFDGSSLRKKATGESKAEKRAFMSSKISKPEPSLSAIPKPLSEKDQEEEEENDRHDKDLKELLATTKLLEEYQLEEMSGK… |
| A0A0C9ZMB4 | 14-290 | EAHGQEFMNSFERPPPLKKRKKHNKLRQTTSPTVHLEERDASGAPEGCGSLSHLDREEGIGHDDERSACSSRAPDVTVFTDAGIKHV… |
| A0A5E3XCX0 | 44-256 | None |
| A0A4P9WGK5 | 43-371 | None |
| A0A2T0FBM7 | 4-230 | None |
| A0A0C2X729 | 2-212 | None |
| A0A674HG05 | 43-348 | None |
| A0A814FGQ0 | 1-181 | None |
| A0A3N4LCH5 | 29-329 | None |
| A0A2K1QL85 | 34-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.