DPCstruct | MC14708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 174 ± 17 aa |
| Standard deviation of domain lengths | 17.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517T1Y6 | 64-229 | HAEIVRHYKKFFQAGADSESQHYAELGSFDEALADAAYAKAADGKRHPHQYRLQRANLQKVHQRLKQYDLESCETFHELFVMVHEAI… |
| A0A2E2FHP4 | 1-190 | MNVDELSNIVNQYLKSDGSWDKTCQALINTKERYEALSLEEAIKHAVNGRTLKESGNFDLDRHQYRIGRSRLDYVYNSITQEEFDKM… |
| D9SPY1 | 6-205 | None |
| A0A426TWM4 | 1-171 | None |
| A0A2D5B2C3 | 10-179 | None |
| A0A522FMB1 | 1-157 | None |
| A0A1T4NJ08 | 9-182 | None |
| A0A4R6T8W6 | 40-215 | None |
| A0A416G6G0 | 12-215 | None |
| A1BGJ4 | 69-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.