DPCstruct | MC14706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 97 ± 16 aa |
| Standard deviation of domain lengths | 16.43 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V2MUD9 | 1-113 | MNNISEKDRVDIARIEYDNYTKIDVQHHKPIRFGENGHKKLLGTLDKVVDDKSTGLRMYVVKTDDKHYSVLFRGSESPGKDGWQKDW… |
| A0A806NKB5 | 1-88 | MKKYIDEEKLQIAMSEYKTIHPNARLKDQYDNTIGVVSEVYDNTSHSGEQVYAVVDNRHIPKEDVKEVTVLFRGSTSPQEFINNLADV |
| A0A7X1CAI2 | 4-123 | None |
| W1VQ87 | 7-100 | None |
| W1V688 | 5-123 | None |
| U6F7D7 | 7-101 | None |
| A0A200JDM4 | 1-82 | None |
| G7SEZ0 | 1-72 | None |
| G7SEZ2 | 7-127 | None |
| A0A4R0QWU0 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.