DPCstruct | MC147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 87 ± 18 aa |
| Standard deviation of domain lengths | 18.09 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519KCV0 | 17-98 | IVRNILGNIIDPTRVTYGTAKTYFPIVLDGDRWKTICRLYQHERLMVGTINERRVETKTRIGKAEDLLQFAHEIKAVANKYR |
| A0A378V507 | 3-82 | EVAPERIHYRDSKSYFAILLDDNNRKPIIRLNLNGKSVKFVTTFEQGKDAGVRRDIASVVDIYKVATDHIRQTIRNYENA |
| A0A2G7H749 | 653-736 | None |
| A0A517WBL0 | 6-80 | None |
| A0A1W1V733 | 487-568 | None |
| A0A378VZ02 | 1-142 | None |
| A0A4Q0MCA7 | 28-113 | None |
| A0A5M9HG72 | 167-248 | None |
| A0A6J4F4Z7 | 1-69 | None |
| A0A7J5RP85 | 212-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.