DPCstruct | MC14698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 176 ± 16 aa |
| Standard deviation of domain lengths | 15.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6LHN1 | 2-181 | QYLYHYFERGREPFQNISAIPIEEAKAVLRHLRQMNPAFADLKDDLTIAWFLRRRKELEELARNLFRQKGGRPLLAVPHYLSFGPSE… |
| A0A1B8UNY0 | 1-194 | MFEFITHYYNAVPFRSLSALSITEAMKVMEELCDDTPIYERFKEPVQYWENRLEAENWLRNRFKEKGGVPKDKYPFYSVLGTADWIE… |
| A0A4V2Y6T7 | 190-368 | None |
| A0A4R3MNJ4 | 6-160 | None |
| A0A7X1B1D8 | 12-216 | None |
| A0A7V8YFN0 | 7-180 | None |
| A0A846X6S1 | 118-293 | None |
| A0A2N3DP08 | 30-211 | None |
| A0A1Y3RKF9 | 2-167 | None |
| A0A1G5HID1 | 12-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.