DPCstruct | MC14697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 187 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1P5N2 | 1-178 | MKLTDYLIFAVIIISSIALPVKIRQDKMLKAEELKIIYNEVVDNSVKDAASMLLEADDNDSLETLSEGRKINFKQSNLNLDKSLWRF… |
| A0A2N0EHW0 | 1-182 | MKITDFVLVIMIVMLPLLLYSDWRSDDTATLSQLNKQYDSALTTATQDATQVLRTNVAPELEAGYSSMKINPTNLDVALKTFLHTLS… |
| A0A0L6JLU0 | 2-206 | None |
| E0S478 | 1-189 | None |
| R6Z992 | 1-199 | None |
| A0A511BYU9 | 1-187 | None |
| A0A7X6YM42 | 1-171 | None |
| A0A1Q6M322 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.