DPCstruct | MC14696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 178 ± 46 aa |
| Standard deviation of domain lengths | 45.60 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 88.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.77 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF05504- CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U9GJX4 | 166-371 | NLRNNHFFSEDYKLIDVFVREQAEGRSIVLPYIELADDNIKATGMAIFKKDKMIGKINMKDSDILNFLRFNNVKGVLTLQKNYKEYI… |
| A0A1B8UJS5 | 48-229 | DDGIEPICSIARFDNNNVSIHGMALFRNGNWVATIPEEDVNFMLTMRHNRMTAPLYIAEKHLNTTQPLIIENAQVRREMRVLRTDPH… |
| A0A336P6Z8 | 97-276 | None |
| A0A354YV34 | 79-268 | None |
| C3DRL5 | 34-201 | None |
| A0A357D6N6 | 26-189 | None |
| A0A5C4T6U7 | 57-221 | None |
| A0A127D803 | 38-249 | None |
| A0A1V3GBB7 | 155-354 | None |
| A0A248TFG2 | 8-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.