DPCstruct | MC14695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 190 ± 29 aa |
| Standard deviation of domain lengths | 28.54 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H3F5U8 | 22-206 | LGFSGAAIGGFIGSTIGSVVDSWIVSSLAPAQRIEGARLDSLRITSSTEGAVIPRLYGRMRIGGNIIWATDFREETKTTSQGGGKGI… |
| A0A838M1F7 | 16-178 | DPVAAGLRIQTSAYGLTLPLVYGRTRIPGNMIWYGDFTAIAHVETTSSGGGGKGGGGEVTSTHTTYTYTAAFALGLGEGPFTAIHAF… |
| A0A2N4WUC8 | 56-226 | None |
| A0A318B4Q1 | 1-231 | None |
| A0A1C9VHN7 | 20-222 | None |
| A0A0P7YJH1 | 48-226 | None |
| A0A848A3F2 | 27-221 | None |
| B6Y7X9 | 50-243 | None |
| A0A656GPJ6 | 10-168 | None |
| A0A6N6QCV5 | 130-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.