DPCstruct | MC14694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 124 ± 11 aa |
| Standard deviation of domain lengths | 10.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A072V5D3 | 1-141 | MNVSRLFMVNVKEEGSFYEESLEETPVADKTKINSGPWFTLDDIPPNRWRERLLEFGAWLDTHLMKTGADSYKIIEEFCCRMKGTLK… |
| A0A067JT46 | 82-225 | LMNDPPMEPKVEHPDDPFDDAHFDLPQDQPVPPRPTSGPWFTFDDVPPSKWRSRILEFNAWLDTQMTFPHTSLKKVIAEFTSRFTGS… |
| A0A392M6N9 | 232-361 | None |
| A0A4U5P6P7 | 320-435 | None |
| A0A068VL12 | 581-706 | None |
| A0A151RSL7 | 1-116 | None |
| A0A151SJ10 | 559-672 | None |
| A0A816XZB2 | 132-241 | None |
| A0A699J6P2 | 172-283 | None |
| A0A151S838 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.