DPCstruct | MC14693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 232 ± 26 aa |
| Standard deviation of domain lengths | 26.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A072UVV1 | 87-283 | VHTHVSVQSSGNDYDILAENVGNRLFFAGEATSRQYPATMHGAFMSGLREASRIYQLNPVQQPCPKKSLSKNIAHNNGILVNLFKRP… |
| B8AIT3 | 101-334 | SPAENVEKVLETLRKIFSPKGIEVPKPLQAICTRWGTDKFTYGSYSYVAIGSSGDDYDILAESVCDRVFFAGEATNRRYPATMHGAL… |
| A0A7N0TM98 | 1-214 | None |
| A0A6A6LRA9 | 173-373 | None |
| A0A6J1IZB6 | 549-752 | None |
| A0A7J0EX48 | 413-630 | None |
| A0A7J9I4P9 | 154-407 | None |
| K3YJA0 | 35-254 | None |
| A0A383WKI0 | 436-712 | None |
| A0A540KR58 | 59-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.