DPCstruct | MC14691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 914 |
|---|---|
| Mean domain length (aa) | 217 ± 41 aa |
| Standard deviation of domain lengths | 41.34 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 14.86 |
| Pfam Score | 70.51 |
| Assigned Pfam label(s) | CL0023- CL0748- PF13154- PF19898- CL0413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0M065 | 1-140 | RERVMFPIRDKRGRVIGFGGRVLGDALPKYLNSPETDIFHKGRQLYGLYEAQQDNAEPPRLLVVEGYMDVVALAQYDINYAVASLGT… |
| A0A072URK0 | 44-251 | EESLGLEPLGPKLVAYFKERLISEKTLSRNSVRQLSDEKNVIAFTYKQNGLIVGCKYRTMEKRFWQGKVIDKVLYGLDDISHATEII… |
| A0A6M0F197 | 55-258 | None |
| A0A2T2W1C7 | 62-314 | None |
| A0A416PFK1 | 113-368 | None |
| A0A357NJC3 | 11-201 | None |
| A0A837Q6Y5 | 63-342 | None |
| A0A139PJD1 | 8-365 | None |
| A0A6J0PLF9 | 40-255 | None |
| A0A0D0RBM4 | 88-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.