DPCstruct | MC14690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 75 ± 2 aa |
| Standard deviation of domain lengths | 1.83 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 80.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 61.77 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF02990- PF09801 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6NL91 | 1-74 | MFYGAMVWDPWLIVSQIVCLQCLYYLSLGVAMALLVGTRVPRLTLLYFFDFATLTPRTPTGWCAIASFILAAVA |
| A0A072UGA5 | 1-75 | MFYGAVVWDPWLIVAQIVCLQCMYYITLGLLLTVLVGTRVSRLSLVYFFDYVTVTTSTVTGWCVCASFLLSSAAG |
| I0YXT6 | 1-74 | None |
| A0A446PSH9 | 1-78 | None |
| M0ZRN7 | 1-74 | None |
| A0A5P1FDX3 | 1-73 | None |
| A0A4V3WIY1 | 503-580 | None |
| A0A7S1HQY9 | 38-110 | None |
| A0A835VBB3 | 90-163 | None |
| A0A388MBL5 | 528-602 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.