DPCstruct | MC1469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 264 ± 47 aa |
| Standard deviation of domain lengths | 47.28 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166QQ00 | 2-211 | DSLMKAANQPENHDQVTFIKALVGEAMLATDKSHLQRYLVKNWKTPVWKGGRGAAPTVSIAQPQRHDPPETWLAWYEVHPQQFLVGI… |
| A0A0C9ZJC5 | 5-288 | TVVLSSTRPRSTCHRHSFPSTSLHLWRLLPRHRHTSRIASLPALSQQSLLLGVTQNWQFATTSHRLTKPPKSIKQIQSFLRAAHQPG… |
| B8P9I2 | 138-324 | None |
| A0A6A4HQN1 | 97-344 | None |
| A0A6A4GSQ2 | 626-965 | None |
| A0A5C3M4K6 | 242-514 | None |
| A0A4Y7QEC1 | 255-585 | None |
| A0A1Q3E523 | 146-422 | None |
| A0A5C3QRT5 | 55-340 | None |
| A0A2G8SLE5 | 77-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.