DPCstruct | MC14689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Standard deviation of domain lengths | 5.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8D2T8 | 62-113 | LEADQDGVIRSETFPGLWLDTKPLLAKDTALMLNTLERGLKSPEHAELVAKL |
| A0A6P0IVF4 | 7-71 | WFSWQEGDYVSLVADQEGIIRSQFFPGLWLAVSALLAEDMVKVMATLQAGLASKEHQEFLQQLAS |
| A0A1Z3HMA4 | 15-78 | None |
| A0A844MNV5 | 12-74 | None |
| A0A7V4HQ71 | 11-70 | None |
| V5V5X9 | 35-91 | None |
| A0A6M0GAN1 | 9-66 | None |
| A0A6N0LNF3 | 2-62 | None |
| A0A6I5PB83 | 41-106 | None |
| A0A2V5MG53 | 4-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.