DPCstruct | MC14688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 233 ± 18 aa |
| Standard deviation of domain lengths | 17.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 53.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257AX73 | 117-335 | MARDEGRHSGFIRLAMRDINADLDLQLLQGEKEFVSMHPKIILYTTYLSEVIGYFRYINIYSHLQAHPEHRYHPIFKYFGGWCQDEL… |
| A0A2Z6D1T7 | 1-233 | MARDEARHAGFLNKAMGDFKLSLDLATVTKTRTYTFFPIEWVLYTVYLSEKIGYWRYIIIYRHLEQHPEHQFYPIFRYFESWCQDEN… |
| A0A453ERJ6 | 13-236 | None |
| A0A7J7Q8W8 | 154-403 | None |
| B9EV82 | 159-408 | None |
| A0A6V7PRL6 | 158-352 | None |
| A0A2P6VQN2 | 156-408 | None |
| A0A087SQT0 | 440-687 | None |
| A0A699YKP6 | 105-325 | None |
| A0A258X664 | 49-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.