DPCstruct | MC14687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 312 ± 43 aa |
| Standard deviation of domain lengths | 43.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 33.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W6MSF2 | 167-477 | YFRDGYRATNYGVPDLVDLIRQIDEKLDGKLGGKRADLSFIGHSMGGFVVTNAVRILSDVFSPAALAAMAGAVEPGSLDERTQREAR… |
| A0A2Z6CVP8 | 128-451 | TSFIKRNEVEKKHSNNRVKLSFIGHSMGCFVITNTIRIVSDVFDSNSLYKDPDSNIGTSFNLERLILVAPDIPVETIITGRANFLRA… |
| A0A2T1C8V9 | 188-490 | None |
| A0A7G8G8G9 | 35-334 | None |
| A0A3M2GQK7 | 338-643 | None |
| A0A841VUN5 | 37-337 | None |
| A0A352AAZ1 | 250-653 | None |
| A0A328UY96 | 2-223 | None |
| K9WY10 | 271-570 | None |
| A0A6B8KC50 | 217-564 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.