DPCstruct | MC14685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 134 ± 17 aa |
| Standard deviation of domain lengths | 17.22 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.87 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 33.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5NG08 | 85-211 | TAWTATNGDTTFDAVVSPVVSGSVADKAQTAVVTDLNADSADVNETVTYTKVGSLVPSSSDGNFPRVPRVVYPNDPRDATKVTPAGV… |
| A0A4Z0S5B1 | 6-164 | TSSAIVYSDWQAVNGDDTFDAKTSPVIPGYIADRLVVDEVAGMDETSEDDIQQVVYRQLGSWVPSVPQVPGVKTPGEVTYPNDPDDP… |
| A0A0R1YTX8 | 316-451 | None |
| A0A0F2CM96 | 135-261 | None |
| A0A0F2CM13 | 1-137 | None |
| A0A4R0QNT4 | 21-160 | None |
| A0A0T8VUL3 | 696-832 | None |
| A0A5P3IKC2 | 1-107 | None |
| A0A4Y9JJK2 | 51-155 | None |
| A0A496L4C1 | 355-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.