DPCstruct | MC14681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 217 ± 26 aa |
| Standard deviation of domain lengths | 25.76 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4S1P5 | 15-254 | AVISAIVSIYGQMRVARLSDRLAKQREAQSREAQTAALMSKYRDPLLRCAIDLQSRLFNIRQNRVLENFDQRCLSEQDYLINNTLYV… |
| A0A7Y4U262 | 12-227 | WAIWSWLQEQEQARALERVRLTALYVNPFLSACEDLQSRIYHILEREGLRILQARYPDGTYAEETFYLIARYFGWAVVLQRYSPYSQ… |
| A0A250XPC3 | 42-288 | None |
| A0A5N6X4Z8 | 1-187 | None |
| A0A194VKW0 | 363-586 | None |
| A0A521G1T2 | 20-222 | None |
| A0A0G2GT33 | 9-209 | None |
| A0A552DY26 | 28-261 | None |
| A0A1L7XYZ4 | 209-383 | None |
| A0A252EGE2 | 2-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.