DPCstruct | MC14680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 223 ± 28 aa |
| Standard deviation of domain lengths | 27.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U3B2X7 | 5-235 | HNILLMFHIAIGTAALLLFWAPALMKKGSLDHVKFGRYYANVMYLVAGSGLIMSTLVLINPMAIHGEGVPPDSAAQVSNQIRIFSAF… |
| A0A290MMY3 | 27-254 | VGRAQKRPMDALFHPALALHISCGLILVGAGLLPLCTTKGSQWHRRAGRVFVVLMSMLLAAAWVMTALRFNAYFAALSSTATLTVFS… |
| A0A3C2ALV8 | 2-224 | None |
| A0A1I5VBC9 | 21-232 | None |
| A0A061NTM8 | 2-204 | None |
| A0A4V6AMD2 | 2-177 | None |
| A0A7S4NRD1 | 29-301 | None |
| A0A5C9A1Q6 | 2-230 | None |
| K2QKE1 | 2-209 | None |
| A0A7Y4R1R9 | 2-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.