DPCstruct | MC1468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 6.98 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 48.35 |
| Pfam Score | 95.24 |
| Assigned Pfam label(s) | PF08033- PF01632- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9ZBG0 | 14-130 | MVVSNELKEPICSHCDIERDSVKHYKRAVKLYEGLAKWASNNGYVVDLFAGCLDQVGLLEMKSLPNFTNGVIVLSDWFATSNFQQSF… |
| A0A818V2M9 | 183-277 | IIIDEELKHTIRSHHDIEKDNAKYMKKAIKFYEGLANRAAVNGHVIDLYSSALDQTGLHEMKYCTNYTGGHMVMGDSFNTSLFKQTF… |
| A0A7J0FVK2 | 419-517 | None |
| A0A0C9YEK4 | 276-371 | None |
| A0A3Q7FCR6 | 353-463 | None |
| A0A7J6RW32 | 154-252 | None |
| L8Y9B9 | 209-304 | None |
| B4E0Q9 | 198-292 | None |
| A0A811MZ27 | 52-147 | None |
| A0A0C9YB40 | 13-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.